19.6 C
İstanbul
Cuma, Haziran 17, 2022

Yemlerin Besin Madde İçerikleri -INRA-2004

Tablo Yemlerin Besin Madde İçeriği-(Havada Kuru =Yediği Formda)-INRA-2004                 KMHPHSHYKULNDFADFADLNİŞASTAŞEKERCaPMgKNaCLSDCADMnZnCuFeSeIUFLUFVPDIAPDINPDIEMERYPPDIE-LYSPDIEMETHYEMLER%%%%%%%%%%g/kgg/kgg/kgg/kgg/kgg/kgmg/Kgmeq/kgmg/kgmg/kgmg/kgmg/kgmg/kgmg/kgkgkgg/kgg/kgg/kgMcal/kg%%PDIE%PDIEArpa86.7010.104.601.802.2018.705.501.0052.202.100.703.401.104.800.101.101.3015.0916.0030.009.00158.000.110.090.950.9330.0069.0087.002.56716.801.90Mısır86.408.102.203.701.2010.402.600.5064.101.600.402.601.003.200.040.501.100.928.0019.002.0032.000.100.091.061.0646.0064.0084.002.80435.701.90Yulaf88.109.8012.204.802.7032.8014.902.6036.201.101.103.201.004.600.101.001.80-18.4140.0023.003.00106.000.190.100.770.7116.0061.0061.002.20817.002.00Kahverengi Pirinç87.408.000.501.201.000.800.600.0075.901.300.101.001.4014.900.200.100.90331.1625.0017.002.0016.000.190.021.081.1023.0055.0066.002.82716.702.10Çavdar87.309.001.901.201.8014.103.100.9053.803.201.003.001.104.500.030.601.3018.4746.0022.005.0057.000.070.081.031.0320.0059.0085.002.72777.102.00Sorgum86.509.402.402.901.409.403.801.1064.101.100.302.801.203.600.200.600.9027.789.0019.004.0058.000.430.021.051.0650.0067.0087.002.80395.401.80Tritikale87.309.602.301.401.9012.703.201.0059.902.700.703.501.004.900.100.901.3023.2920.0020.006.0058.000.040.091.011.0220.0063.0084.002.70797.102.00Buğday-Makarnalık87.6014.502.701.801.9014.403.701.1055.502.700.803.401.104.600.101.301.70-20.6350.0015.007.0070.000.06 1.021.0235.0096.0096.002.72766.301.90Buğday -Yumuşak86.8010.502.201.501.6012.403.101.0060.502.400.703.201.004.000.100.901.50-12.2334.0027.005.0047.000.120.061.021.0226.0070.0089.002.70766.701.90Buğday kepeği87.1014.809.203.405.0039.6011.903.4019.806.701.409.904.2012.300.100.901.90175.29112.0074.0017.00143.000.470.080.820.7733.0094.0080.002.29756.701.90Kepekli Un88.1015.507.003.604.3031.309.202.6027.706.201.308.703.5010.900.101.001.60155.35100.0091.0012.0094.000.620.090.900.8736.00101.0087.002.48766.701.90Bonkalite87.9014.904.903.503.4022.906.501.9037.805.501.207.102.309.100.100.802.0089.9597.0081.0014.00116.000.710.110.980.9635.0098.0090.002.65766.801.90Buğday unu88.2012.701.502.401.409.802.200.4059.704.000.903.601.605.300.200.601.5033.8650.0040.006.0014.000.600.051.101.1131.0084.0095.002.91766.801.90Makarna kepeği86.6014.6010.104.404.9043.2013.003.7019.906.601.409.402.7011.900.100.802.40136.67232.0069.0015.00 0.430.090.800.7431.0093.0075.002.25766.701.90Makarna razmol86.9015.407.104.304.0031.609.302.7029.705.901.208.102.3010.300.200.701.70146.5687.0070.0012.00 0.520.080.900.8735.00100.0085.002.48766.701.90Buğday DDGS-nişasta<%790.0033.809.206.503.6037.9014.604.003.800.803.306.702.707.900.501.902.5014.4120.0063.009.00 0.360.180.960.90102.00228.00143.002.68685.502.00Buğday DDGS-nişasta>%791.4028.905.605.104.7025.308.402.5012.603.501.908.102.808.000.501.902.6010.7320.0064.009.00 0.370.181.041.0163.00187.00118.002.87775.602.00Buğday gluten yemi,nişasta %2590.6014.705.604.007.4028.308.202.7024.802.701.207.402.909.2016.408.403.00524.8483.0062.007.00 0.360.050.950.9333.0096.0087.002.60766.601.90Buğday gluten yemi,nişasta %2887.9014.506.102.804.1028.508.402.7027.905.501.607.502.3011.300.901.902.60112.6181.0061.007.00 0.350.040.940.9133.0094.0086.002.56766.601.90Mısır DDGS88.2024.607.303.906.0031.409.001.6011.500.502.108.402.9012.405.403.203.20262.4219.0065.0010.00105.000.340.030.970.94108.00181.00154.002.65565.201.90Mısır...

NRC 2021 Dairy Nutrition Model (NASEM)

NRC 2021 Süt Sığırı Besin Madde Gereksinme Modeli 22 Aralık 2021 Tarihinde yayınlanmıştır. Sektöre Faydalı Olmasını diliyorum. Model Linki: https://drive.google.com/drive/folders/1t9a0fNPEHu2fDXYK59vwSdu2V2FjIlWY?usp=sharing Değişimler (Prof.Dr. Bill Weiss): https://ecommons.cornell.edu/bitstream/handle/1813/110230/Weiss%2c%20Bill.pdf?sequence=2&isAllowed=y

Süt Sığırı Rasyonlarında Hammadde Kullanımı İle İlgili Kriterler

HammaddelerMAX, % KM*Kg/inekAçıklamaÜre, en fazla1.50.10-0.15Fazla kullanılması toksisiteye, yavru atmalar, erken embriyo ölümüne ve aşırı idrar boşaltımına neden olur.Kuru melas61Fazlası yüksek K içeriği nedeniyle iştahı...

Doğrusal Programlama ve Excel Çözücü Uygulamasıyla Optimum Rasyon Çözümü

KESİF YEM DATABASE KESİF YEM DUYARLILIK ANALİZİ TMR DATABASE

Düve TMR Rasyon Programı

DUVE-ASFED-WEB-1İndir Not: EXCEL'de Hazırlanan TMR Programları Deneme Niteliğinde Verilmiştir.  Doğrusal Programlama (LP) yaklaşımıyla Optimizasyon Yapılmaktadır. Program Office 2007 EXCEL'de hazırlanmıştır. Düşük Versiyonlu Office Programlarında Uyumluluk Sorunu Yaşanabilir.

Kuru Dönem TMR Programı

KURU-ASFED-WEB-1İndir Not: EXCEL'de Hazırlanan TMR Programları Deneme Niteliğinde Verilmiştir.  Doğrusal Programlama (LP) yaklaşımıyla Optimizasyon Yapılmaktadır. Program Office 2007 EXCEL'de hazırlanmıştır. Düşük Versiyonlu Office Programlarında Uyumluluk Sorunu Yaşanabilir.

Besi TMR Rasyon programı

BESI-ASFED-WEB-1İndir Not: EXCEL'de Hazırlanan TMR Programları Deneme Niteliğinde Verilmiştir.  Doğrusal Programlama (LP) yaklaşımıyla Optimizasyon Yapılmaktadır. Program Office 2007 EXCEL'de hazırlanmıştır. Düşük Versiyonlu Office Programlarında Uyumluluk Sorunu Yaşanabilir.