24.9 C
İstanbul
Cumartesi, Haziran 25, 2022

Doğrusal Programlama ve Excel Çözücü Uygulamasıyla Optimum Rasyon Çözümü

KESİF YEM DATABASE KESİF YEM DUYARLILIK ANALİZİ TMR DATABASE

Yemlerin Besin Madde İçerikleri -INRA-2004

Tablo Yemlerin Besin Madde İçeriği-(Havada Kuru =Yediği Formda)-INRA-2004                 KMHPHSHYKULNDFADFADLNİŞASTAŞEKERCaPMgKNaCLSDCADMnZnCuFeSeIUFLUFVPDIAPDINPDIEMERYPPDIE-LYSPDIEMETHYEMLER%%%%%%%%%%g/kgg/kgg/kgg/kgg/kgg/kgmg/Kgmeq/kgmg/kgmg/kgmg/kgmg/kgmg/kgmg/kgkgkgg/kgg/kgg/kgMcal/kg%%PDIE%PDIEArpa86.7010.104.601.802.2018.705.501.0052.202.100.703.401.104.800.101.101.3015.0916.0030.009.00158.000.110.090.950.9330.0069.0087.002.56716.801.90Mısır86.408.102.203.701.2010.402.600.5064.101.600.402.601.003.200.040.501.100.928.0019.002.0032.000.100.091.061.0646.0064.0084.002.80435.701.90Yulaf88.109.8012.204.802.7032.8014.902.6036.201.101.103.201.004.600.101.001.80-18.4140.0023.003.00106.000.190.100.770.7116.0061.0061.002.20817.002.00Kahverengi Pirinç87.408.000.501.201.000.800.600.0075.901.300.101.001.4014.900.200.100.90331.1625.0017.002.0016.000.190.021.081.1023.0055.0066.002.82716.702.10Çavdar87.309.001.901.201.8014.103.100.9053.803.201.003.001.104.500.030.601.3018.4746.0022.005.0057.000.070.081.031.0320.0059.0085.002.72777.102.00Sorgum86.509.402.402.901.409.403.801.1064.101.100.302.801.203.600.200.600.9027.789.0019.004.0058.000.430.021.051.0650.0067.0087.002.80395.401.80Tritikale87.309.602.301.401.9012.703.201.0059.902.700.703.501.004.900.100.901.3023.2920.0020.006.0058.000.040.091.011.0220.0063.0084.002.70797.102.00Buğday-Makarnalık87.6014.502.701.801.9014.403.701.1055.502.700.803.401.104.600.101.301.70-20.6350.0015.007.0070.000.06 1.021.0235.0096.0096.002.72766.301.90Buğday -Yumuşak86.8010.502.201.501.6012.403.101.0060.502.400.703.201.004.000.100.901.50-12.2334.0027.005.0047.000.120.061.021.0226.0070.0089.002.70766.701.90Buğday kepeği87.1014.809.203.405.0039.6011.903.4019.806.701.409.904.2012.300.100.901.90175.29112.0074.0017.00143.000.470.080.820.7733.0094.0080.002.29756.701.90Kepekli Un88.1015.507.003.604.3031.309.202.6027.706.201.308.703.5010.900.101.001.60155.35100.0091.0012.0094.000.620.090.900.8736.00101.0087.002.48766.701.90Bonkalite87.9014.904.903.503.4022.906.501.9037.805.501.207.102.309.100.100.802.0089.9597.0081.0014.00116.000.710.110.980.9635.0098.0090.002.65766.801.90Buğday unu88.2012.701.502.401.409.802.200.4059.704.000.903.601.605.300.200.601.5033.8650.0040.006.0014.000.600.051.101.1131.0084.0095.002.91766.801.90Makarna kepeği86.6014.6010.104.404.9043.2013.003.7019.906.601.409.402.7011.900.100.802.40136.67232.0069.0015.00 0.430.090.800.7431.0093.0075.002.25766.701.90Makarna razmol86.9015.407.104.304.0031.609.302.7029.705.901.208.102.3010.300.200.701.70146.5687.0070.0012.00 0.520.080.900.8735.00100.0085.002.48766.701.90Buğday DDGS-nişasta<%790.0033.809.206.503.6037.9014.604.003.800.803.306.702.707.900.501.902.5014.4120.0063.009.00 0.360.180.960.90102.00228.00143.002.68685.502.00Buğday DDGS-nişasta>%791.4028.905.605.104.7025.308.402.5012.603.501.908.102.808.000.501.902.6010.7320.0064.009.00 0.370.181.041.0163.00187.00118.002.87775.602.00Buğday gluten yemi,nişasta %2590.6014.705.604.007.4028.308.202.7024.802.701.207.402.909.2016.408.403.00524.8483.0062.007.00 0.360.050.950.9333.0096.0087.002.60766.601.90Buğday gluten yemi,nişasta %2887.9014.506.102.804.1028.508.402.7027.905.501.607.502.3011.300.901.902.60112.6181.0061.007.00 0.350.040.940.9133.0094.0086.002.56766.601.90Mısır DDGS88.2024.607.303.906.0031.409.001.6011.500.502.108.402.9012.405.403.203.20262.4219.0065.0010.00105.000.340.030.970.94108.00181.00154.002.65565.201.90Mısır...

Yemlerin Besin Madde Kompozisyonları Kuru Madde Bazli-NRC-2001

Tablo. Değişik Yemlerin Besin Madde İçerikleri (Kuru Madde Bazında, NRC-2001) YemlerKMTDNMENELHPHYNDFADFKülCaPMg KNaCl SKM(%25)KM(%50)RUPSLysMetBirim%%Mcal/kgMcal/kg%%%%%%%%%%%%%%%% HP% HPBadem Kabuğu86.9058.401.891.146.502.9036.8028.706.100.280.130.132.620.020.030.0450.6055.70    50.00      2.74      0.90   Yaş Elma Posası35.9057.101.861.127.705.0052.5043.202.600.200.140.090.730.040.030.0724.2031.70    80.00      3.93      1.38   Fırıncılık Artıkları, Un yan...

NRC 2021 Dairy Nutrition Model (NASEM)

NRC 2021 Süt Sığırı Besin Madde Gereksinme Modeli 22 Aralık 2021 Tarihinde yayınlanmıştır. Sektöre Faydalı Olmasını diliyorum. Model Linki: https://drive.google.com/drive/folders/1t9a0fNPEHu2fDXYK59vwSdu2V2FjIlWY?usp=sharing Değişimler (Prof.Dr. Bill Weiss): https://ecommons.cornell.edu/bitstream/handle/1813/110230/Weiss%2c%20Bill.pdf?sequence=2&isAllowed=y

Küçükbaş NRC 2007 (SRNS) Rasyon Programı

Küçükbaş NRC 2007 (SRNS) Rasyon Programı

Süt Keçisi TMR Programı

KECI-ASFED-WEB-1İndir Not: EXCEL'de Hazırlanan TMR Programları Deneme Niteliğinde Verilmiştir.  Doğrusal Programlama (LP) yaklaşımıyla Optimizasyon Yapılmaktadır. Program Office 2007 EXCEL'de hazırlanmıştır. Düşük Versiyonlu Office Programlarında Uyumluluk Sorunu Yaşanabilir.

Besi TMR Rasyon programı

BESI-ASFED-WEB-1İndir Not: EXCEL'de Hazırlanan TMR Programları Deneme Niteliğinde Verilmiştir.  Doğrusal Programlama (LP) yaklaşımıyla Optimizasyon Yapılmaktadır. Program Office 2007 EXCEL'de hazırlanmıştır. Düşük Versiyonlu Office Programlarında Uyumluluk Sorunu Yaşanabilir.

Düve TMR Rasyon Programı

DUVE-ASFED-WEB-1İndir Not: EXCEL'de Hazırlanan TMR Programları Deneme Niteliğinde Verilmiştir.  Doğrusal Programlama (LP) yaklaşımıyla Optimizasyon Yapılmaktadır. Program Office 2007 EXCEL'de hazırlanmıştır. Düşük Versiyonlu Office Programlarında Uyumluluk Sorunu Yaşanabilir.

Süt Sığırı İşletmelerinde Kaba Yem Üretimi ve Kullanımının Optimizasyonu

Ç.Ü.Z.F. Dergisi, (1998)J.Agric. Fac. Ç.Ü., (1998):13(1):81-90 The Optimisation Of Roughage Production And Usage In Dairy Farm Murat GÖRGÜLÜHasan R. KUTLUÇ.Ü.Ziraat FakültesiÇ.Ü.Ziraat FakültesiZootekni BölümüZootekni Bölümü01330 Adana01330 Adana  Andrzej...